Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145998.1 | internal | 123 | 1-369(+) |
Amino Acid sequence : | |||
EKTKSLEMDFRVMGLDAPMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPDSYVFLVDMPGVKSGEIGVQVEDDNLLVITGERKREDDKDQHHKYLRMERRMG KFM | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,622.392 | ||
Theoretical pI: | 5.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 36.771 | ||
aromaticity | 0.024 | ||
GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.179 | ||
sheet | 0.285 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145998.1 | internal | 123 | 369-1(-) |
Amino Acid sequence : | |||
HELPHPPLHPQILVVLILVVLALPLSGDDEEVVVLHLDPDLAGLDTWHVDEEDVRVGELLDVERGVGHGGRVADVATGRAGRLLLLQRRIGTGHVLHQVVEGRQHRSIQSHHSEIHFQTL CFL | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,622.392 | ||
Theoretical pI: | 5.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 36.771 | ||
aromaticity | 0.024 | ||
GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.179 | ||
sheet | 0.285 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145998.1 | internal | 123 | 1-369(+) |
Amino Acid sequence : | |||
EKTKSLEMDFRVMGLDAPMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPDSYVFLVDMPGVKSGEIGVQVEDDNLLVITGERKREDDKDQHHKYLRMERRMG KFM | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,622.392 | ||
Theoretical pI: | 5.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 36.771 | ||
aromaticity | 0.024 | ||
GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.179 | ||
sheet | 0.285 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145998.1 | internal | 123 | 369-1(-) |
Amino Acid sequence : | |||
HELPHPPLHPQILVVLILVVLALPLSGDDEEVVVLHLDPDLAGLDTWHVDEEDVRVGELLDVERGVGHGGRVADVATGRAGRLLLLQRRIGTGHVLHQVVEGRQHRSIQSHHSEIHFQTL CFL | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,622.392 | ||
Theoretical pI: | 5.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 36.771 | ||
aromaticity | 0.024 | ||
GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.179 | ||
sheet | 0.285 |