| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146013.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
| HASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTFALTDDGTVHSF GSCTNFCLGHGDQHDELLPRAIQS | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,401.090 | ||
| Theoretical pI: | 6.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 15.020 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.257 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146013.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
| HASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCKQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTFALTDDGTVHSF GSCTNFCLGHGDQHDELLPRAIQS | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,401.090 | ||
| Theoretical pI: | 6.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 15.020 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.257 | ||
| sheet | 0.194 | ||