| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146052.1 | 5prime_partial | 149 | 3-452(+) |
Amino Acid sequence : | |||
| TSLRMELDIQRFIQNCDQQQFEFPHLPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSDIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIRTV EERKEEYDKARARIFTHPPSPELGRSFLY* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,990.892 | ||
| Theoretical pI: | 8.861 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 57.592 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.803 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.255 | ||
| sheet | 0.215 | ||