Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146053.1 | internal | 128 | 1-384(+) |
Amino Acid sequence : | |||
EKTKSLEMDFRVMGLDAPMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPDSYVFLVDVPGVKSGEIGVQVEDDNLLVITGERKREDDKDQHHKYLRMERRMG KFMRKFSL | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,246.137 | ||
Theoretical pI: | 5.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 39.777 | ||
aromaticity | 0.023 | ||
GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.180 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146053.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
KRELPHELPHPPLHPQILVVLILVVLALPLSGDDEEVVVLHLDPDLAGLDTWHVDEEDVRVGELLDVERGVGHGGRVADVATGRAGRLLLLQRRIGTGHVLHQVVEGRQHRSIQSHHSEI HFQTLCFL | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,246.137 | ||
Theoretical pI: | 5.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 39.777 | ||
aromaticity | 0.023 | ||
GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.180 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146053.1 | internal | 128 | 1-384(+) |
Amino Acid sequence : | |||
EKTKSLEMDFRVMGLDAPMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPDSYVFLVDVPGVKSGEIGVQVEDDNLLVITGERKREDDKDQHHKYLRMERRMG KFMRKFSL | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,246.137 | ||
Theoretical pI: | 5.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 39.777 | ||
aromaticity | 0.023 | ||
GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.180 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146053.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
KRELPHELPHPPLHPQILVVLILVVLALPLSGDDEEVVVLHLDPDLAGLDTWHVDEEDVRVGELLDVERGVGHGGRVADVATGRAGRLLLLQRRIGTGHVLHQVVEGRQHRSIQSHHSEI HFQTLCFL | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,246.137 | ||
Theoretical pI: | 5.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 39.777 | ||
aromaticity | 0.023 | ||
GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.180 | ||
sheet | 0.289 |