| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146055.1 | 3prime_partial | 167 | 81-581(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKH | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 17,571.033 | ||
| Theoretical pI: | 7.685 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 31.930 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.263 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146055.1 | 3prime_partial | 167 | 81-581(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKH | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 17,571.033 | ||
| Theoretical pI: | 7.685 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 31.930 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.263 | ||
| sheet | 0.234 | ||