| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146060.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
| RRSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQG MTLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFV | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,370.693 | ||
| Theoretical pI: | 8.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
| Instability index: | 34.954 | ||
| aromaticity | 0.137 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.416 | ||
| turn | 0.226 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146060.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
| RRSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQG MTLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFV | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,370.693 | ||
| Theoretical pI: | 8.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
| Instability index: | 34.954 | ||
| aromaticity | 0.137 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.416 | ||
| turn | 0.226 | ||
| sheet | 0.305 | ||