Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146079.1 | internal | 164 | 494-3(-) |
Amino Acid sequence : | |||
ILEAHHSQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALN TCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSK | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 16,116.940 | ||
Theoretical pI: | 5.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 49.919 | ||
aromaticity | 0.079 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.221 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146079.1 | 5prime_partial | 140 | 1-423(+) |
Amino Acid sequence : | |||
SFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLT VTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,116.940 | ||
Theoretical pI: | 5.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 49.919 | ||
aromaticity | 0.079 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.221 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146079.1 | internal | 164 | 494-3(-) |
Amino Acid sequence : | |||
ILEAHHSQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALN TCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSK | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 16,116.940 | ||
Theoretical pI: | 5.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 49.919 | ||
aromaticity | 0.079 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.221 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146079.1 | 5prime_partial | 140 | 1-423(+) |
Amino Acid sequence : | |||
SFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLT VTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,116.940 | ||
Theoretical pI: | 5.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 49.919 | ||
aromaticity | 0.079 | ||
GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.221 | ||
sheet | 0.243 |