Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146086.1	internal	180	540-1(-)
Amino Acid sequence :
HKRGNNQPQDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTC ASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDI
Physicochemical properties
Number of amino acids:		180
Molecular weight:		17,928.992
Theoretical pI:		5.836
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		56.542
aromaticity		0.089
GRAVY		-0.666
Secondary Structure Fraction
Helix		0.274
turn		0.248
sheet		0.229

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146086.1	complete	157	2-475(+)
Amino Acid sequence :
MSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPE NAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG*
Physicochemical properties
Number of amino acids:		157
Molecular weight:		17,928.992
Theoretical pI:		5.836
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		56.542
aromaticity		0.089
GRAVY		-0.666
Secondary Structure Fraction
Helix		0.274
turn		0.248
sheet		0.229