| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146091.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| PSLTAGVHGGSVFASIVQAPEDPILGVTVAFNKDPSPVKVNLGVGAYRTEEGKPLVLDVVRRAEQMLVNDRSRVKEYLPITGLTDFNKLSAKLIFGAESPAIHENRVTTAQCLSGTGSLR VGGEFLAKHYHERTIYIPSPTWGNHIKVFALAGLSVKTYRYYDPATRGLNFQGLLEDLASAPAGAIVLLHACAHNP | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 10,794.300 | ||
| Theoretical pI: | 11.271 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.079 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.343 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146091.1 | 3prime_partial | 103 | 310-2(-) |
Amino Acid sequence : | |||
| MNGRAFGSKDELSTKLVKICQSCDRKILLNTRPIVHQHLLRSPYHVQNKRLPFLGPIRADAEIHLHRARILVKRNSNPENRILRRLDDAGEYGSAMDSGGQRR | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,794.300 | ||
| Theoretical pI: | 11.271 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.079 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.343 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146091.1 | 3prime_partial | 102 | 306-1(-) |
Amino Acid sequence : | |||
| MAGLSAPKMSLALSLLKSVNPVIGRYSLTRDRSFTSICSARLTTSKTSGFPSSVRYAPTPRFTFTGLGSLLNATVTPRIGSSGAWTMLANTDPPWTPAVRDG | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,794.300 | ||
| Theoretical pI: | 11.271 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.079 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.343 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146091.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| PSLTAGVHGGSVFASIVQAPEDPILGVTVAFNKDPSPVKVNLGVGAYRTEEGKPLVLDVVRRAEQMLVNDRSRVKEYLPITGLTDFNKLSAKLIFGAESPAIHENRVTTAQCLSGTGSLR VGGEFLAKHYHERTIYIPSPTWGNHIKVFALAGLSVKTYRYYDPATRGLNFQGLLEDLASAPAGAIVLLHACAHNP | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 10,794.300 | ||
| Theoretical pI: | 11.271 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.079 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.343 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146091.1 | 3prime_partial | 103 | 310-2(-) |
Amino Acid sequence : | |||
| MNGRAFGSKDELSTKLVKICQSCDRKILLNTRPIVHQHLLRSPYHVQNKRLPFLGPIRADAEIHLHRARILVKRNSNPENRILRRLDDAGEYGSAMDSGGQRR | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,794.300 | ||
| Theoretical pI: | 11.271 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.079 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.343 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146091.1 | 3prime_partial | 102 | 306-1(-) |
Amino Acid sequence : | |||
| MAGLSAPKMSLALSLLKSVNPVIGRYSLTRDRSFTSICSARLTTSKTSGFPSSVRYAPTPRFTFTGLGSLLNATVTPRIGSSGAWTMLANTDPPWTPAVRDG | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,794.300 | ||
| Theoretical pI: | 11.271 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.079 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.343 | ||
| sheet | 0.225 | ||