Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146091.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
PSLTAGVHGGSVFASIVQAPEDPILGVTVAFNKDPSPVKVNLGVGAYRTEEGKPLVLDVVRRAEQMLVNDRSRVKEYLPITGLTDFNKLSAKLIFGAESPAIHENRVTTAQCLSGTGSLR VGGEFLAKHYHERTIYIPSPTWGNHIKVFALAGLSVKTYRYYDPATRGLNFQGLLEDLASAPAGAIVLLHACAHNP | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 10,794.300 | ||
Theoretical pI: | 11.271 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 32.079 | ||
aromaticity | 0.078 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146091.1 | 3prime_partial | 103 | 310-2(-) |
Amino Acid sequence : | |||
MNGRAFGSKDELSTKLVKICQSCDRKILLNTRPIVHQHLLRSPYHVQNKRLPFLGPIRADAEIHLHRARILVKRNSNPENRILRRLDDAGEYGSAMDSGGQRR | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,794.300 | ||
Theoretical pI: | 11.271 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 32.079 | ||
aromaticity | 0.078 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146091.1 | 3prime_partial | 102 | 306-1(-) |
Amino Acid sequence : | |||
MAGLSAPKMSLALSLLKSVNPVIGRYSLTRDRSFTSICSARLTTSKTSGFPSSVRYAPTPRFTFTGLGSLLNATVTPRIGSSGAWTMLANTDPPWTPAVRDG | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,794.300 | ||
Theoretical pI: | 11.271 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 32.079 | ||
aromaticity | 0.078 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146091.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
PSLTAGVHGGSVFASIVQAPEDPILGVTVAFNKDPSPVKVNLGVGAYRTEEGKPLVLDVVRRAEQMLVNDRSRVKEYLPITGLTDFNKLSAKLIFGAESPAIHENRVTTAQCLSGTGSLR VGGEFLAKHYHERTIYIPSPTWGNHIKVFALAGLSVKTYRYYDPATRGLNFQGLLEDLASAPAGAIVLLHACAHNP | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 10,794.300 | ||
Theoretical pI: | 11.271 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 32.079 | ||
aromaticity | 0.078 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146091.1 | 3prime_partial | 103 | 310-2(-) |
Amino Acid sequence : | |||
MNGRAFGSKDELSTKLVKICQSCDRKILLNTRPIVHQHLLRSPYHVQNKRLPFLGPIRADAEIHLHRARILVKRNSNPENRILRRLDDAGEYGSAMDSGGQRR | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,794.300 | ||
Theoretical pI: | 11.271 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 32.079 | ||
aromaticity | 0.078 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146091.1 | 3prime_partial | 102 | 306-1(-) |
Amino Acid sequence : | |||
MAGLSAPKMSLALSLLKSVNPVIGRYSLTRDRSFTSICSARLTTSKTSGFPSSVRYAPTPRFTFTGLGSLLNATVTPRIGSSGAWTMLANTDPPWTPAVRDG | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,794.300 | ||
Theoretical pI: | 11.271 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 32.079 | ||
aromaticity | 0.078 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.225 |