| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146097.1 | internal | 188 | 2-565(+) |
Amino Acid sequence : | |||
| NDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK KMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQNQAPQRELWLSFWSEVHYNSLYDLRD | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,911.703 | ||
| Theoretical pI: | 9.067 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 41.959 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.202 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146097.1 | internal | 188 | 2-565(+) |
Amino Acid sequence : | |||
| NDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK KMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQNQAPQRELWLSFWSEVHYNSLYDLRD | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,911.703 | ||
| Theoretical pI: | 9.067 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 41.959 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.202 | ||
| sheet | 0.234 | ||