| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146098.1 | 3prime_partial | 168 | 60-563(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,836.514 | ||
| Theoretical pI: | 7.899 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 25.761 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.161 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146098.1 | 3prime_partial | 168 | 60-563(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,836.514 | ||
| Theoretical pI: | 7.899 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 25.761 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.161 | ||
| sheet | 0.238 | ||