Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146102.1	5prime_partial	147	1-444(+)
Amino Acid sequence :
SPGLQEFGTRNAKVAFELSERLPHLSLRMKEHSHRGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFRE QHQQRVEHSGQGACRHLPRTSQDVCRL*
Physicochemical properties
Number of amino acids:		147
Molecular weight:		14,400.371
Theoretical pI:		6.898
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		36.968
aromaticity		0.069
GRAVY		-0.363
Secondary Structure Fraction
Helix		0.244
turn		0.298
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146102.1	complete	131	128-523(+)
Amino Acid sequence :
MKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAI SRMQVDVHAKN*
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,400.371
Theoretical pI:		6.898
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		36.968
aromaticity		0.069
GRAVY		-0.363
Secondary Structure Fraction
Helix		0.244
turn		0.298
sheet		0.282