| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146108.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| HEGKFVTEILAMALAFRLLSRSKQFYASQVILQQGHGVFVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERITIDPEDPAAVRQYANIMKMIREKAGLMTENEKVEYTVT HITKDIPDARTYLLKLKEIRIKSGIEDTIGGEAMMMEALDKIEKQIGKPLLRSDRKNVALLQAE | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 20,932.334 | ||
| Theoretical pI: | 9.156 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 53.527 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.250 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.141 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146108.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| HEGKFVTEILAMALAFRLLSRSKQFYASQVILQQGHGVFVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERITIDPEDPAAVRQYANIMKMIREKAGLMTENEKVEYTVT HITKDIPDARTYLLKLKEIRIKSGIEDTIGGEAMMMEALDKIEKQIGKPLLRSDRKNVALLQAE | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 20,932.334 | ||
| Theoretical pI: | 9.156 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 53.527 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.250 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.141 | ||
| sheet | 0.321 | ||