| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146124.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
| RHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLVYGTKEG KLRVLQFYGSQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,586.788 | ||
| Theoretical pI: | 5.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
| Instability index: | 46.069 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.208 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146124.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
| RHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLVYGTKEG KLRVLQFYGSQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,586.788 | ||
| Theoretical pI: | 5.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
| Instability index: | 46.069 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.208 | ||
| sheet | 0.289 | ||