Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146124.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
RHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLVYGTKEG KLRVLQFYGSQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,586.788 | ||
Theoretical pI: | 5.775 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
Instability index: | 46.069 | ||
aromaticity | 0.081 | ||
GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.208 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146124.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
RHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLVYGTKEG KLRVLQFYGSQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,586.788 | ||
Theoretical pI: | 5.775 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
Instability index: | 46.069 | ||
aromaticity | 0.081 | ||
GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.208 | ||
sheet | 0.289 |