| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146155.1 | internal | 224 | 2-673(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTLLKELVDMGFKQIDLN | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 24,375.942 | ||
| Theoretical pI: | 4.379 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 34.142 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.295 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146155.1 | internal | 224 | 2-673(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTLLKELVDMGFKQIDLN | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 24,375.942 | ||
| Theoretical pI: | 4.379 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 34.142 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.295 | ||
| sheet | 0.223 | ||