| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146166.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| PGCRNSAPAKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVAN LKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 13,489.944 | ||
| Theoretical pI: | 11.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 53.215 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.182 | ||
| turn | 0.339 | ||
| sheet | 0.149 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146166.1 | 5prime_partial | 121 | 2-367(+) |
Amino Acid sequence : | |||
| PGLQEFGTSKVRPGTHPRRQFNRPVPRHEARCSCHDPCSLPRLHHFHVQYCVGERRHNPSRVRLFEARGGGANQVRGIRARNTRNPCELRLPSAPFHSSDHGLLQQDRGGGGGGDGFRGK S* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,489.944 | ||
| Theoretical pI: | 11.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 53.215 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.182 | ||
| turn | 0.339 | ||
| sheet | 0.149 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146166.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| PGCRNSAPAKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVAN LKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 13,489.944 | ||
| Theoretical pI: | 11.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 53.215 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.182 | ||
| turn | 0.339 | ||
| sheet | 0.149 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146166.1 | 5prime_partial | 121 | 2-367(+) |
Amino Acid sequence : | |||
| PGLQEFGTSKVRPGTHPRRQFNRPVPRHEARCSCHDPCSLPRLHHFHVQYCVGERRHNPSRVRLFEARGGGANQVRGIRARNTRNPCELRLPSAPFHSSDHGLLQQDRGGGGGGDGFRGK S* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,489.944 | ||
| Theoretical pI: | 11.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 53.215 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.182 | ||
| turn | 0.339 | ||
| sheet | 0.149 | ||