Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146175.1 | internal | 153 | 2-460(+) |
Amino Acid sequence : | |||
YSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIY EDELNNFLEKRALSELVVAFSREGPTKEYVQHK | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 11,894.433 | ||
Theoretical pI: | 9.386 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
Instability index: | 56.350 | ||
aromaticity | 0.126 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.291 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146175.1 | complete | 103 | 52-363(+) |
Amino Acid sequence : | |||
MCFGSWTNTHGKNSQRNLLNMDEECSSTGGKPKLQLGSCICEAIKFQTSFRSIYSYYYDWSWYRVSTLQGLLAGKVGIEGRRRRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,894.433 | ||
Theoretical pI: | 9.386 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
Instability index: | 56.350 | ||
aromaticity | 0.126 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.291 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146175.1 | internal | 153 | 2-460(+) |
Amino Acid sequence : | |||
YSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIY EDELNNFLEKRALSELVVAFSREGPTKEYVQHK | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 11,894.433 | ||
Theoretical pI: | 9.386 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
Instability index: | 56.350 | ||
aromaticity | 0.126 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.291 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146175.1 | complete | 103 | 52-363(+) |
Amino Acid sequence : | |||
MCFGSWTNTHGKNSQRNLLNMDEECSSTGGKPKLQLGSCICEAIKFQTSFRSIYSYYYDWSWYRVSTLQGLLAGKVGIEGRRRRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,894.433 | ||
Theoretical pI: | 9.386 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
Instability index: | 56.350 | ||
aromaticity | 0.126 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.291 | ||
sheet | 0.214 |