Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146177.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
KHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,704.892 | ||
Theoretical pI: | 4.921 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 20.482 | ||
aromaticity | 0.078 | ||
GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.275 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146177.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
KHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,704.892 | ||
Theoretical pI: | 4.921 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 20.482 | ||
aromaticity | 0.078 | ||
GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.275 | ||
sheet | 0.265 |