Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146203.1 | internal | 218 | 2-655(+) |
Amino Acid sequence : | |||
HEKDFVKRLLNKDYRKRMTASQALRHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVKLLHGFSSRSMP | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 25,068.880 | ||
Theoretical pI: | 9.283 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 37.492 | ||
aromaticity | 0.096 | ||
GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.193 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146203.1 | internal | 218 | 2-655(+) |
Amino Acid sequence : | |||
HEKDFVKRLLNKDYRKRMTASQALRHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVKLLHGFSSRSMP | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 25,068.880 | ||
Theoretical pI: | 9.283 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 37.492 | ||
aromaticity | 0.096 | ||
GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.193 | ||
sheet | 0.280 |