| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146217.1 | internal | 155 | 2-466(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPS | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,006.673 | ||
| Theoretical pI: | 4.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 32.695 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.316 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146217.1 | internal | 155 | 2-466(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPS | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,006.673 | ||
| Theoretical pI: | 4.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 32.695 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.316 | ||
| sheet | 0.200 | ||