| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146226.1 | 5prime_partial | 137 | 1-414(+) |
Amino Acid sequence : | |||
| ARANQAAAPEEIVQMARIKVHELRGKSKADLLNQLKDLKADLALLRVAKVTGGAPNKLSKIKVVRLGIAQVLTVISQKQKEALREVYKKKTFLPLDLRPKKTRAIRRKLTKHQASLKTER EKKREMYFPMRKYAIKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,665.599 | ||
| Theoretical pI: | 10.776 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 30.303 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.560 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.117 | ||
| sheet | 0.328 | ||