Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146245.1 | internal | 207 | 623-3(-) |
Amino Acid sequence : | |||
RWHVLYPLGSDQVLVVPPLSRQVHRKLWLPVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDER VVVRIEHVAIPNVLILHRPTDPIEEGEVDREVRVLVEAEERVDVDHEGRLVGVEEPDHLDHEAADVSTKRARRWDRLVPNSCSPGDP | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 23,015.029 | ||
Theoretical pI: | 5.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
Instability index: | 35.197 | ||
aromaticity | 0.130 | ||
GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.280 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146245.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
WIPRAAGIRHEPVPSAGAFRADISGLMVEMVRFLDANKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANL DYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLIDENMKSVMPGTFERHWGIFTYDGKPKFPMDLSGQGGHNKYLVGAKGIEYMPT | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 23,015.029 | ||
Theoretical pI: | 5.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
Instability index: | 35.197 | ||
aromaticity | 0.130 | ||
GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.280 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146245.1 | internal | 207 | 623-3(-) |
Amino Acid sequence : | |||
RWHVLYPLGSDQVLVVPPLSRQVHRKLWLPVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDER VVVRIEHVAIPNVLILHRPTDPIEEGEVDREVRVLVEAEERVDVDHEGRLVGVEEPDHLDHEAADVSTKRARRWDRLVPNSCSPGDP | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 23,015.029 | ||
Theoretical pI: | 5.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
Instability index: | 35.197 | ||
aromaticity | 0.130 | ||
GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.280 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146245.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
WIPRAAGIRHEPVPSAGAFRADISGLMVEMVRFLDANKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANL DYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLIDENMKSVMPGTFERHWGIFTYDGKPKFPMDLSGQGGHNKYLVGAKGIEYMPT | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 23,015.029 | ||
Theoretical pI: | 5.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
Instability index: | 35.197 | ||
aromaticity | 0.130 | ||
GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.280 | ||
sheet | 0.227 |