Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146252.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
TSGTFSVPRLRSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFR QIMAHFSDVAEAYIEKRNQDRPYMPRYGLQRNLTDMSLARYAFDFYEMTSRTPIRAREAHIQMKAAALRG | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 22,062.108 | ||
Theoretical pI: | 7.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 47.227 | ||
aromaticity | 0.100 | ||
GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.195 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146252.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
TSGTFSVPRLRSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFR QIMAHFSDVAEAYIEKRNQDRPYMPRYGLQRNLTDMSLARYAFDFYEMTSRTPIRAREAHIQMKAAALRG | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 22,062.108 | ||
Theoretical pI: | 7.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 47.227 | ||
aromaticity | 0.100 | ||
GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.195 | ||
sheet | 0.284 |