| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146278.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| HEWSDKALHISAINQTKWWFAKRFLHPDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAP VFSRAAWRCVWHMIQNDLIHAWGLDKKLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFAVRQRSYIEQEI | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 24,004.783 | ||
| Theoretical pI: | 8.350 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57660 | ||
| Instability index: | 43.645 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.608 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.213 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146278.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| HEWSDKALHISAINQTKWWFAKRFLHPDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAP VFSRAAWRCVWHMIQNDLIHAWGLDKKLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFAVRQRSYIEQEI | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 24,004.783 | ||
| Theoretical pI: | 8.350 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57660 | ||
| Instability index: | 43.645 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.608 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.213 | ||
| sheet | 0.193 | ||