| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146282.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
| YSDIAGPEYAAKYKTLIYLAGSASAEVIADVALCPMEAVKVRVQTQPGFARGLSDGLPKFVKAEGALGLYKGLVPLWGRQIPYTMMKFASFEAIVEMMYKYVIPVPKDQCSKQLQLGVSF AGGYVAGIFCAVVSHPADNLVSF | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,407.900 | ||
| Theoretical pI: | 8.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 22.030 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.224 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146282.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
| YSDIAGPEYAAKYKTLIYLAGSASAEVIADVALCPMEAVKVRVQTQPGFARGLSDGLPKFVKAEGALGLYKGLVPLWGRQIPYTMMKFASFEAIVEMMYKYVIPVPKDQCSKQLQLGVSF AGGYVAGIFCAVVSHPADNLVSF | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,407.900 | ||
| Theoretical pI: | 8.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 22.030 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.224 | ||
| sheet | 0.287 | ||