| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146284.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
| GPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRV | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,766.186 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 24.818 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.217 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146284.1 | internal | 120 | 2-361(+) |
Amino Acid sequence : | |||
| GPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSEL | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,766.186 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 24.818 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.217 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146284.1 | internal | 120 | 361-2(-) |
Amino Acid sequence : | |||
| QLAAGAAPGTRHEGLVVPERDGHEPKLRGVLEVVHETVRPFLGAHVDAHHASESVPGVGHGFEELVVGVVLEARVDHLEAHLLHAGRVGQRPVAVLFHSEGEVGETLRELERHLGIHGGA | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,766.186 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 24.818 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.217 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146284.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
| GPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRV | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,766.186 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 24.818 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.217 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146284.1 | internal | 120 | 2-361(+) |
Amino Acid sequence : | |||
| GPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSEL | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,766.186 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 24.818 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.217 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146284.1 | internal | 120 | 361-2(-) |
Amino Acid sequence : | |||
| QLAAGAAPGTRHEGLVVPERDGHEPKLRGVLEVVHETVRPFLGAHVDAHHASESVPGVGHGFEELVVGVVLEARVDHLEAHLLHAGRVGQRPVAVLFHSEGEVGETLRELERHLGIHGGA | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,766.186 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 24.818 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.217 | ||
| sheet | 0.342 | ||