Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146284.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
GPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRV | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,766.186 | ||
Theoretical pI: | 5.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.818 | ||
aromaticity | 0.025 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.217 | ||
sheet | 0.342 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146284.1 | internal | 120 | 2-361(+) |
Amino Acid sequence : | |||
GPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSEL | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,766.186 | ||
Theoretical pI: | 5.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.818 | ||
aromaticity | 0.025 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.217 | ||
sheet | 0.342 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146284.1 | internal | 120 | 361-2(-) |
Amino Acid sequence : | |||
QLAAGAAPGTRHEGLVVPERDGHEPKLRGVLEVVHETVRPFLGAHVDAHHASESVPGVGHGFEELVVGVVLEARVDHLEAHLLHAGRVGQRPVAVLFHSEGEVGETLRELERHLGIHGGA | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,766.186 | ||
Theoretical pI: | 5.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.818 | ||
aromaticity | 0.025 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.217 | ||
sheet | 0.342 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146284.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
GPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRV | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,766.186 | ||
Theoretical pI: | 5.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.818 | ||
aromaticity | 0.025 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.217 | ||
sheet | 0.342 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146284.1 | internal | 120 | 2-361(+) |
Amino Acid sequence : | |||
GPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSEL | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,766.186 | ||
Theoretical pI: | 5.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.818 | ||
aromaticity | 0.025 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.217 | ||
sheet | 0.342 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146284.1 | internal | 120 | 361-2(-) |
Amino Acid sequence : | |||
QLAAGAAPGTRHEGLVVPERDGHEPKLRGVLEVVHETVRPFLGAHVDAHHASESVPGVGHGFEELVVGVVLEARVDHLEAHLLHAGRVGQRPVAVLFHSEGEVGETLRELERHLGIHGGA | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,766.186 | ||
Theoretical pI: | 5.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.818 | ||
aromaticity | 0.025 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.217 | ||
sheet | 0.342 |