| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146287.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| TSNEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVA VEITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLS | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 15,204.412 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 43.714 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.227 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146287.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLPHRRIC FLIVEIKSFVAR | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,204.412 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 43.714 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.227 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146287.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| TSNEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVA VEITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLS | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 15,204.412 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 43.714 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.227 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146287.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLPHRRIC FLIVEIKSFVAR | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,204.412 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 43.714 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.227 | ||
| sheet | 0.258 | ||