| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146288.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| PRAAGIRHEECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQ HQQRVEHSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,000.250 | ||
| Theoretical pI: | 8.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 40.290 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.297 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146288.1 | internal | 145 | 2-436(+) |
Amino Acid sequence : | |||
| PGLQEFGTRNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSS TSSELSTQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,000.250 | ||
| Theoretical pI: | 8.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 40.290 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.297 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146288.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| PRAAGIRHEECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQ HQQRVEHSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,000.250 | ||
| Theoretical pI: | 8.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 40.290 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.297 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146288.1 | internal | 145 | 2-436(+) |
Amino Acid sequence : | |||
| PGLQEFGTRNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSS TSSELSTQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,000.250 | ||
| Theoretical pI: | 8.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 40.290 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.297 | ||
| sheet | 0.324 | ||