Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146296.1 | internal | 105 | 316-2(-) |
Amino Acid sequence : | |||
DRLSILVRISANFTAMWEVWQSRTGAYPLPIWPGWFMMMTWEVKLAASFAGSSLECEATKPLFRSLTATFFTLNPTLSPGRASRRDSWCISTDLTSVVSPVGPKV | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,366.761 | ||
Theoretical pI: | 6.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 43.285 | ||
aromaticity | 0.057 | ||
GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.248 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146296.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
TFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASHSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRS | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,366.761 | ||
Theoretical pI: | 6.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 43.285 | ||
aromaticity | 0.057 | ||
GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.248 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146296.1 | internal | 105 | 316-2(-) |
Amino Acid sequence : | |||
DRLSILVRISANFTAMWEVWQSRTGAYPLPIWPGWFMMMTWEVKLAASFAGSSLECEATKPLFRSLTATFFTLNPTLSPGRASRRDSWCISTDLTSVVSPVGPKV | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,366.761 | ||
Theoretical pI: | 6.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 43.285 | ||
aromaticity | 0.057 | ||
GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.248 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146296.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
TFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASHSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRS | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,366.761 | ||
Theoretical pI: | 6.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 43.285 | ||
aromaticity | 0.057 | ||
GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.248 | ||
sheet | 0.229 |