| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146296.1 | internal | 105 | 316-2(-) |
Amino Acid sequence : | |||
| DRLSILVRISANFTAMWEVWQSRTGAYPLPIWPGWFMMMTWEVKLAASFAGSSLECEATKPLFRSLTATFFTLNPTLSPGRASRRDSWCISTDLTSVVSPVGPKV | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,366.761 | ||
| Theoretical pI: | 6.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.285 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146296.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| TFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASHSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRS | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,366.761 | ||
| Theoretical pI: | 6.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.285 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146296.1 | internal | 105 | 316-2(-) |
Amino Acid sequence : | |||
| DRLSILVRISANFTAMWEVWQSRTGAYPLPIWPGWFMMMTWEVKLAASFAGSSLECEATKPLFRSLTATFFTLNPTLSPGRASRRDSWCISTDLTSVVSPVGPKV | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,366.761 | ||
| Theoretical pI: | 6.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.285 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146296.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| TFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASHSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRS | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,366.761 | ||
| Theoretical pI: | 6.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.285 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||