| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146300.1 | internal | 135 | 3-407(+) |
Amino Acid sequence : | |||
| RRERETIMALRAAVNRIPLNRPLHAVTSSRIVRSSPSYCPRVVFRCQSGIPSEAKMEPMTELKYKNNASERWKIKMLYDGDCPLCMREVNMLRERNKSYGAIKFVDISSKDYSPEENEGL DYQTVMGRIHAILSD | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,613.860 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 61.807 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.244 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146300.1 | internal | 135 | 3-407(+) |
Amino Acid sequence : | |||
| RRERETIMALRAAVNRIPLNRPLHAVTSSRIVRSSPSYCPRVVFRCQSGIPSEAKMEPMTELKYKNNASERWKIKMLYDGDCPLCMREVNMLRERNKSYGAIKFVDISSKDYSPEENEGL DYQTVMGRIHAILSD | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,613.860 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 61.807 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.244 | ||
| sheet | 0.259 | ||