Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146303.1 | 5prime_partial | 177 | 3-536(+) |
Amino Acid sequence : | |||
ANSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQE QPPEAVNNNPVFAAVRSKVAENLNHAAPETRANPGQPWVRGWDDKRGLESGPKYGNQ* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 20,090.358 | ||
Theoretical pI: | 9.448 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 55.360 | ||
aromaticity | 0.062 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.294 | ||
sheet | 0.282 |