| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146304.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
| RKLSEIFEHFEETPVASGSIAQVHRASLRFQYPGQQLKKPIEVAVKVRHPGVGESIRRDFVIINLVATISSVIPALSWLRLDESVRQFAVFMLSQVDLAREASNLSRFIYNFRSRRWKDV SFPKPLYPLIHPSVLVETFEQGESVSHYIDDLQGNAHINKDLAHNGTHAFLKMLLFPPLLG | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,629.509 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 50.836 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.232 | ||
| sheet | 0.249 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146304.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
| RKLSEIFEHFEETPVASGSIAQVHRASLRFQYPGQQLKKPIEVAVKVRHPGVGESIRRDFVIINLVATISSVIPALSWLRLDESVRQFAVFMLSQVDLAREASNLSRFIYNFRSRRWKDV SFPKPLYPLIHPSVLVETFEQGESVSHYIDDLQGNAHINKDLAHNGTHAFLKMLLFPPLLG | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,629.509 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 50.836 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.232 | ||
| sheet | 0.249 | ||