Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146318.1 | 5prime_partial | 139 | 2-421(+) |
Amino Acid sequence : | |||
RALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQR WGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 12,775.061 | ||
Theoretical pI: | 9.676 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 57.716 | ||
aromaticity | 0.018 | ||
GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.292 | ||
sheet | 0.168 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146318.1 | 5prime_partial | 113 | 1-342(+) |
Amino Acid sequence : | |||
PGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,775.061 | ||
Theoretical pI: | 9.676 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 57.716 | ||
aromaticity | 0.018 | ||
GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.292 | ||
sheet | 0.168 |