Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146320.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
HKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIYEDELNNFLEKGALSELVVAFSREGPTKEYV QHKMAEKASEIWNVISKGGYIYVCGD | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,405.581 | ||
Theoretical pI: | 5.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 43.178 | ||
aromaticity | 0.110 | ||
GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.267 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146320.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
HKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIYEDELNNFLEKGALSELVVAFSREGPTKEYV QHKMAEKASEIWNVISKGGYIYVCGD | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,405.581 | ||
Theoretical pI: | 5.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 43.178 | ||
aromaticity | 0.110 | ||
GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.267 | ||
sheet | 0.274 |