| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146331.1 | internal | 143 | 2-430(+) |
Amino Acid sequence : | |||
| AHKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLI DENMKSVMPGTFERHWGIFTYDG | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,006.934 | ||
| Theoretical pI: | 4.881 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.565 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.371 | ||
| turn | 0.196 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146331.1 | internal | 143 | 430-2(-) |
Amino Acid sequence : | |||
| PVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVD REVRVLVEAEERVDVDHEGRLVG | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,006.934 | ||
| Theoretical pI: | 4.881 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.565 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.371 | ||
| turn | 0.196 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146331.1 | internal | 143 | 2-430(+) |
Amino Acid sequence : | |||
| AHKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLI DENMKSVMPGTFERHWGIFTYDG | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,006.934 | ||
| Theoretical pI: | 4.881 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.565 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.371 | ||
| turn | 0.196 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146331.1 | internal | 143 | 430-2(-) |
Amino Acid sequence : | |||
| PVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVD REVRVLVEAEERVDVDHEGRLVG | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,006.934 | ||
| Theoretical pI: | 4.881 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.565 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.371 | ||
| turn | 0.196 | ||
| sheet | 0.245 | ||