Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146333.1	internal	152	1-456(+)
Amino Acid sequence :
ARALTKQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERS SGKFLRRFRMPENAKVEEVRASMENGVLTVTV
Physicochemical properties
Number of amino acids:		152
Molecular weight:		16,574.007
Theoretical pI:		8.231
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		65.620
aromaticity		0.027
GRAVY		-0.259
Secondary Structure Fraction
Helix		0.331
turn		0.243
sheet		0.345

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146333.1	internal	152	458-3(-)
Amino Acid sequence :
GTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQ RSKDEEGSNTREPNPNGTSDILIVLICLVNAR
Physicochemical properties
Number of amino acids:		152
Molecular weight:		16,574.007
Theoretical pI:		8.231
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		65.620
aromaticity		0.027
GRAVY		-0.259
Secondary Structure Fraction
Helix		0.331
turn		0.243
sheet		0.345

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146333.1	5prime_partial	148	456-10(-)
Amino Acid sequence :
HGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPE IEGRGGIEHSRTESEWNKRHLDCFDLLG*
Physicochemical properties
Number of amino acids:		148
Molecular weight:		16,574.007
Theoretical pI:		8.231
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		65.620
aromaticity		0.027
GRAVY		-0.259
Secondary Structure Fraction
Helix		0.331
turn		0.243
sheet		0.345

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146333.1	internal	152	1-456(+)
Amino Acid sequence :
ARALTKQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERS SGKFLRRFRMPENAKVEEVRASMENGVLTVTV
Physicochemical properties
Number of amino acids:		152
Molecular weight:		16,574.007
Theoretical pI:		8.231
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		65.620
aromaticity		0.027
GRAVY		-0.259
Secondary Structure Fraction
Helix		0.331
turn		0.243
sheet		0.345

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146333.1	internal	152	458-3(-)
Amino Acid sequence :
GTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQ RSKDEEGSNTREPNPNGTSDILIVLICLVNAR
Physicochemical properties
Number of amino acids:		152
Molecular weight:		16,574.007
Theoretical pI:		8.231
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		65.620
aromaticity		0.027
GRAVY		-0.259
Secondary Structure Fraction
Helix		0.331
turn		0.243
sheet		0.345

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX146333.1	5prime_partial	148	456-10(-)
Amino Acid sequence :
HGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPE IEGRGGIEHSRTESEWNKRHLDCFDLLG*
Physicochemical properties
Number of amino acids:		148
Molecular weight:		16,574.007
Theoretical pI:		8.231
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		65.620
aromaticity		0.027
GRAVY		-0.259
Secondary Structure Fraction
Helix		0.331
turn		0.243
sheet		0.345