Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146333.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
ARALTKQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERS SGKFLRRFRMPENAKVEEVRASMENGVLTVTV | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,574.007 | ||
Theoretical pI: | 8.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 65.620 | ||
aromaticity | 0.027 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.243 | ||
sheet | 0.345 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146333.1 | internal | 152 | 458-3(-) |
Amino Acid sequence : | |||
GTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQ RSKDEEGSNTREPNPNGTSDILIVLICLVNAR | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,574.007 | ||
Theoretical pI: | 8.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 65.620 | ||
aromaticity | 0.027 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.243 | ||
sheet | 0.345 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146333.1 | 5prime_partial | 148 | 456-10(-) |
Amino Acid sequence : | |||
HGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPE IEGRGGIEHSRTESEWNKRHLDCFDLLG* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,574.007 | ||
Theoretical pI: | 8.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 65.620 | ||
aromaticity | 0.027 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.243 | ||
sheet | 0.345 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146333.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
ARALTKQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERS SGKFLRRFRMPENAKVEEVRASMENGVLTVTV | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,574.007 | ||
Theoretical pI: | 8.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 65.620 | ||
aromaticity | 0.027 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.243 | ||
sheet | 0.345 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146333.1 | internal | 152 | 458-3(-) |
Amino Acid sequence : | |||
GTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQ RSKDEEGSNTREPNPNGTSDILIVLICLVNAR | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,574.007 | ||
Theoretical pI: | 8.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 65.620 | ||
aromaticity | 0.027 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.243 | ||
sheet | 0.345 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146333.1 | 5prime_partial | 148 | 456-10(-) |
Amino Acid sequence : | |||
HGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPE IEGRGGIEHSRTESEWNKRHLDCFDLLG* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,574.007 | ||
Theoretical pI: | 8.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 65.620 | ||
aromaticity | 0.027 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.243 | ||
sheet | 0.345 |