| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146334.1 | internal | 121 | 3-365(+) |
Amino Acid sequence : | |||
| RETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPLANLLYSFNWELPAGIFKDDINMDESPGIAIHRKYALH L | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,889.856 | ||
| Theoretical pI: | 6.069 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 40.885 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.256 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146334.1 | internal | 121 | 3-365(+) |
Amino Acid sequence : | |||
| RETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPLANLLYSFNWELPAGIFKDDINMDESPGIAIHRKYALH L | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,889.856 | ||
| Theoretical pI: | 6.069 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 40.885 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.256 | ||
| sheet | 0.240 | ||