| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146345.1 | 5prime_partial | 117 | 582-229(-) |
Amino Acid sequence : | |||
| RAMITVTIIVSRIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHAAATVATVELPYRYSIGSPAVVPVSAQIQVANTISGTARTLNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,568.854 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 51.154 | ||
| aromaticity | 0.138 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.224 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146345.1 | complete | 116 | 3-353(+) |
Amino Acid sequence : | |||
| MAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSIIPQPQDNQQVVGPCLYTVQIHTSCLSPPKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGSVRYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,568.854 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 51.154 | ||
| aromaticity | 0.138 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.224 | ||
| sheet | 0.172 | ||