Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146348.1 | internal | 116 | 2-349(+) |
Amino Acid sequence : | |||
VPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGYTFGAGMFEMEEVKGGSPYGSGTFAGDGSR | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,069.550 | ||
Theoretical pI: | 5.143 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 26.596 | ||
aromaticity | 0.121 | ||
GRAVY | 0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.284 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146348.1 | internal | 116 | 2-349(+) |
Amino Acid sequence : | |||
VPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGYTFGAGMFEMEEVKGGSPYGSGTFAGDGSR | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,069.550 | ||
Theoretical pI: | 5.143 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 26.596 | ||
aromaticity | 0.121 | ||
GRAVY | 0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.284 | ||
sheet | 0.267 |