| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146352.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| LISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGNDGWRPDTVT VRKLNSRNSRSTMFKFDSVLPNNIWCGFDRCRGEISSPP | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 14,763.951 | ||
| Theoretical pI: | 8.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.950 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.230 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146352.1 | 5prime_partial | 139 | 478-59(-) |
Amino Acid sequence : | |||
| GRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLH RVEALPYDLLIILGLWNNG* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,763.951 | ||
| Theoretical pI: | 8.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.950 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.230 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146352.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| LISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGNDGWRPDTVT VRKLNSRNSRSTMFKFDSVLPNNIWCGFDRCRGEISSPP | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 14,763.951 | ||
| Theoretical pI: | 8.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.950 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.230 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146352.1 | 5prime_partial | 139 | 478-59(-) |
Amino Acid sequence : | |||
| GRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLH RVEALPYDLLIILGLWNNG* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,763.951 | ||
| Theoretical pI: | 8.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.950 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.230 | ||
| sheet | 0.302 | ||