Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146354.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
APRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIPLARRIRGER A* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,772.004 | ||
Theoretical pI: | 10.807 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 39.063 | ||
aromaticity | 0.058 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.132 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146354.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
APRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIPLARRIRGER A* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,772.004 | ||
Theoretical pI: | 10.807 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 39.063 | ||
aromaticity | 0.058 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.132 | ||
sheet | 0.306 |