| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146355.1 | 3prime_partial | 207 | 38-658(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRT | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 21,775.862 | ||
| Theoretical pI: | 8.477 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 29.174 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.186 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.266 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146355.1 | 3prime_partial | 207 | 38-658(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRT | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 21,775.862 | ||
| Theoretical pI: | 8.477 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 29.174 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.186 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.266 | ||
| sheet | 0.227 | ||