| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146357.1 | internal | 149 | 447-1(-) |
Amino Acid sequence : | |||
| RTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVL ANAEVSLGKLEFARGTTSRKKLSMGSQRS | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 15,882.689 | ||
| Theoretical pI: | 5.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 49.604 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.825 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.217 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146357.1 | 5prime_partial | 138 | 2-418(+) |
Amino Acid sequence : | |||
| DLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLTVT VPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,882.689 | ||
| Theoretical pI: | 5.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 49.604 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.825 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.217 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146357.1 | internal | 149 | 447-1(-) |
Amino Acid sequence : | |||
| RTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVL ANAEVSLGKLEFARGTTSRKKLSMGSQRS | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 15,882.689 | ||
| Theoretical pI: | 5.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 49.604 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.825 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.217 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146357.1 | 5prime_partial | 138 | 2-418(+) |
Amino Acid sequence : | |||
| DLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLTVT VPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,882.689 | ||
| Theoretical pI: | 5.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 49.604 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.825 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.217 | ||
| sheet | 0.246 | ||