Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146360.1 | internal | 148 | 2-445(+) |
Amino Acid sequence : | |||
ASSVEGVDVKLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGY TFGAGMFEMEEVKGGSPYGSGTFAGDGS | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 10,447.078 | ||
Theoretical pI: | 8.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 72.410 | ||
aromaticity | 0.029 | ||
GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.400 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146360.1 | 3prime_partial | 105 | 315-1(-) |
Amino Acid sequence : | |||
MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLTSTPSTDDA | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,447.078 | ||
Theoretical pI: | 8.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 72.410 | ||
aromaticity | 0.029 | ||
GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.400 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146360.1 | internal | 148 | 2-445(+) |
Amino Acid sequence : | |||
ASSVEGVDVKLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGY TFGAGMFEMEEVKGGSPYGSGTFAGDGS | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 10,447.078 | ||
Theoretical pI: | 8.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 72.410 | ||
aromaticity | 0.029 | ||
GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.400 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146360.1 | 3prime_partial | 105 | 315-1(-) |
Amino Acid sequence : | |||
MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLTSTPSTDDA | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,447.078 | ||
Theoretical pI: | 8.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 72.410 | ||
aromaticity | 0.029 | ||
GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.400 | ||
sheet | 0.238 |