| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146363.1 | 5prime_partial | 145 | 3-440(+) |
Amino Acid sequence : | |||
| LMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPESYVFLVDMPGVKSGEIRVQVEDDNLLVITGERKREDDRDQHHKYLRMERRMGKFMRKFSLPENVDTENGISAICQDG VLTVTVQKKPPPEPKKPKTIEVKIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,436.608 | ||
| Theoretical pI: | 5.799 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 37.837 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.705 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.207 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146363.1 | 5prime_partial | 145 | 3-440(+) |
Amino Acid sequence : | |||
| LMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPESYVFLVDMPGVKSGEIRVQVEDDNLLVITGERKREDDRDQHHKYLRMERRMGKFMRKFSLPENVDTENGISAICQDG VLTVTVQKKPPPEPKKPKTIEVKIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,436.608 | ||
| Theoretical pI: | 5.799 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 37.837 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.705 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.207 | ||
| sheet | 0.248 | ||