| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146364.1 | internal | 107 | 1-321(+) |
Amino Acid sequence : | |||
| GKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGV | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,229.549 | ||
| Theoretical pI: | 4.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 25.864 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.234 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146364.1 | internal | 107 | 1-321(+) |
Amino Acid sequence : | |||
| GKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGV | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,229.549 | ||
| Theoretical pI: | 4.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 25.864 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.234 | ||
| sheet | 0.224 | ||