Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146367.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPD | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,390.500 | ||
Theoretical pI: | 4.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 30.843 | ||
aromaticity | 0.086 | ||
GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.352 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146367.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPD | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,390.500 | ||
Theoretical pI: | 4.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 30.843 | ||
aromaticity | 0.086 | ||
GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.352 | ||
sheet | 0.181 |