| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146367.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPD | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,390.500 | ||
| Theoretical pI: | 4.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 30.843 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.352 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146367.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPD | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,390.500 | ||
| Theoretical pI: | 4.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 30.843 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.352 | ||
| sheet | 0.181 | ||