| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146372.1 | internal | 133 | 1-399(+) |
Amino Acid sequence : | |||
| KENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKACNTNVCLKHRFPSDHS CTNLLLLPTMRKG | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,089.485 | ||
| Theoretical pI: | 8.947 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2365 | ||
| Instability index: | 42.801 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.188 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146372.1 | internal | 133 | 1-399(+) |
Amino Acid sequence : | |||
| KENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKACNTNVCLKHRFPSDHS CTNLLLLPTMRKG | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,089.485 | ||
| Theoretical pI: | 8.947 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2365 | ||
| Instability index: | 42.801 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.188 | ||
| sheet | 0.233 | ||