Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146381.1 | internal | 101 | 3-305(+) |
Amino Acid sequence : | |||
SSPIHKCIEATHACYNDCASYMLERLAKGTGSVVLATHNLDSGNAAAAKARELGIGKGNQKLQFSQLMGMADGLSLGLKNAGFIVSKYLPYGPVDQVIPYL | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,671.187 | ||
Theoretical pI: | 8.475 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 32.257 | ||
aromaticity | 0.069 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.277 | ||
sheet | 0.297 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146381.1 | internal | 101 | 3-305(+) |
Amino Acid sequence : | |||
SSPIHKCIEATHACYNDCASYMLERLAKGTGSVVLATHNLDSGNAAAAKARELGIGKGNQKLQFSQLMGMADGLSLGLKNAGFIVSKYLPYGPVDQVIPYL | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,671.187 | ||
Theoretical pI: | 8.475 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 32.257 | ||
aromaticity | 0.069 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.277 | ||
sheet | 0.297 |