Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146400.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
LSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEIQQLRDLRRVN QELL | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,567.383 | ||
Theoretical pI: | 4.603 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 36.047 | ||
aromaticity | 0.024 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.202 | ||
sheet | 0.363 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146400.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
LSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEIQQLRDLRRVN QELL | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,567.383 | ||
Theoretical pI: | 4.603 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 36.047 | ||
aromaticity | 0.024 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.202 | ||
sheet | 0.363 |