| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146400.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
| LSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEIQQLRDLRRVN QELL | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,567.383 | ||
| Theoretical pI: | 4.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 36.047 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.202 | ||
| sheet | 0.363 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146400.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
| LSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEIQQLRDLRRVN QELL | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,567.383 | ||
| Theoretical pI: | 4.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 36.047 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.202 | ||
| sheet | 0.363 | ||